PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010543617.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 230aa    MW: 26387 Da    PI: 7.9129
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010543617.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.32.3e-10100144347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       W++ E++l++ + +++G g+W++I+r +  ++t+ q+ s+ qky
   XP_010543617.1 100 VWSAYEHKLFLIGLQRYGRGDWRSISRNVVMTKTPLQIASHAQKY 144
                      7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.031151IPR017877Myb-like domain
SMARTSM0071747253IPR001005SANT/Myb domain
SuperFamilySSF466891.72E-5450IPR009057Homeodomain-like
PROSITE profilePS5129412.95193149IPR017930Myb domain
SuperFamilySSF466895.98E-1395149IPR009057Homeodomain-like
SMARTSM007173.5E-697147IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.6E-1399148IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-6100143IPR009057Homeodomain-like
PfamPF002495.4E-9100144IPR001005SANT/Myb domain
CDDcd001673.36E-6101145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MAANPWTRAE DQVLEEGLAT FAGFLPDRLQ RIAEILQRPF WDVYVHYSTL ALDAPEIASG  60
RVNTPGYDDV RSEIPVSQVS ETAEPAKAHG AGRKRRESKV WSAYEHKLFL IGLQRYGRGD  120
WRSISRNVVM TKTPLQIASH AQKYFIRQEL PPERKRRSIH DDNTVDMDLV AKLFPQWLDA  180
FQPQPQPQVL QPLPLLSMNQ QFMLVQGHAQ LPPRDYQSLG QFPGDLDFRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010543618.11e-170PREDICTED: transcription factor DIVARICATA-like isoform X3
RefseqXP_010543617.11e-170PREDICTED: transcription factor DIVARICATA-like isoform X3
TrEMBLA0A078FMH63e-49A0A078FMH6_BRANA; BnaC02g02590D protein
TrEMBLA0A0D3AHT33e-49A0A0D3AHT3_BRAOL; Uncharacterized protein
STRINGBra005818.1-P3e-46(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.16e-47MYB family protein